Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046506_circ_g.1 |
ID in PlantcircBase | zma_circ_009979 |
Alias | zma_circ_0003258 |
Organism | Zea mays |
Position | chr9: 92961124-92961947 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d046506 |
Parent gene annotation |
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subuni t A beta isoform |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d046506_T002:4 Zm00001d046506_T004:4 Zm00001d046506_T003:4 Zm00001d046506_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_038561 |
PMCS | 0.163144094 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
92961893-92961151(+) 92961460-92961222(+) |
Potential amino acid sequence |
MFVQLWHRLLWEWLLYWERPRFSATIGS*(+) MVANQLYELCEAVGTEPTRGDLVSAYVRLLCDNEAEVRIAAAGKVTKFCKILNPQIAIEHILPC IKELSSDSSQHVRSALASVIMGMAPVLGKTKIQCDYWQLRVVLLLGSCWSPKIVQHIFSQLL*( +) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |