Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d046506_circ_g.1 |
| ID in PlantcircBase | zma_circ_009979 |
| Alias | zma_circ_0003258 |
| Organism | Zea mays |
| Position | chr9: 92961124-92961947 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d046506 |
| Parent gene annotation |
Serine/threonine-protein phosphatase 2A 65 kDa regulatory subuni t A beta isoform |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d046506_T002:4 Zm00001d046506_T004:4 Zm00001d046506_T003:4 Zm00001d046506_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_038561 |
| PMCS | 0.163144094 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
92961893-92961151(+) 92961460-92961222(+) |
| Potential amino acid sequence |
MFVQLWHRLLWEWLLYWERPRFSATIGS*(+) MVANQLYELCEAVGTEPTRGDLVSAYVRLLCDNEAEVRIAAAGKVTKFCKILNPQIAIEHILPC IKELSSDSSQHVRSALASVIMGMAPVLGKTKIQCDYWQLRVVLLLGSCWSPKIVQHIFSQLL*( +) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |