Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_17G191000_circ_g.2 |
| ID in PlantcircBase | gma_circ_007461 |
| Alias | gma-circRNA2361 |
| Organism | Glycine max |
| Position | chr17: 27074344-27075703 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_17G191000 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | + |
| Alternative splicing | GLYMA_17G191000_circ_g.1 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | KRH04838:3 KRH04839:3 KRH04840:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.210602984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27074387-27074359(+) 27074629-27074414(+) 27074550-27075670(-) |
| Potential amino acid sequence |
MHVAERDVLHEMVKIVKKKPDFHVKEKILVLVDTWQEAFGGPRARYPQYYAAYQELLRAGAVFP QRSEQSAPVFTPPQTQPLASYPQNIRDTNVDQDAAQSSAESEFPTLNCWRQS*(+) MLHTRNCCVLGQYSLRGRNNLHLYSHLHKHSHWHLTLKIYATQMLTRTQLSPLQSLSFQHSIVG DNHKELWRYCSHACCRKRCAS*(+) MKIRLFLYYFHHLMKHISFCNMHVNNISTVLYDCLQQLSVGNSDSAED*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |