Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0467600_circ_g.1 |
| ID in PlantcircBase | osa_circ_028191 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 22959041-22960487 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder, find_circ |
| Parent gene | Os05g0467600 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0467600-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 16 |
| Tissues | anther, seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0467600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203977073 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22960380-22959042(+) 22959205-22960398(-) 22959089-22960390(-) |
| Potential amino acid sequence |
MIKSCTYCVKLSRSLSWNCPKATERLWGGFGVLSDEA*(+) MAATDSRRLADLDDDELDRLLPLIKVTHFAAHRTSAPGGCGCPCAATRRMEEGQASSERTPNPP HNRSVAFGQFQERLRESFTQ*(-) MWLSLCGDEADGRGSGLVGEDSKSPPQSLSRLWTIPRKTPRKLYAVST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |