Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0669200_circ_g.4 |
ID in PlantcircBase | osa_circ_020914 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 26401228-26401652 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder |
Parent gene | Os03g0669200 |
Parent gene annotation |
Heterotrimeric G protein b-subunit, Regulation of cellular proli feration, Seed fertility (Os03t0669200-01) |
Parent gene strand | - |
Alternative splicing | Os03g0669200_circ_g.1 Os03g0669200_circ_g.2 Os03g0669200_circ_g.3 |
Support reads | 6 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0669200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013397 |
PMCS | 0.492128196 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26401525-26401615(-) |
Potential amino acid sequence |
MTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLIT SSGDQTCVLWDVTTGQRISIFGGEFPSGHTADVLRYILWIGPLKRIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |