Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0669200_circ_g.4 |
| ID in PlantcircBase | osa_circ_020914 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 26401228-26401652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder |
| Parent gene | Os03g0669200 |
| Parent gene annotation |
Heterotrimeric G protein b-subunit, Regulation of cellular proli feration, Seed fertility (Os03t0669200-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0669200_circ_g.1 Os03g0669200_circ_g.2 Os03g0669200_circ_g.3 |
| Support reads | 6 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0669200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013397 |
| PMCS | 0.492128196 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26401525-26401615(-) |
| Potential amino acid sequence |
MTCAFAPNGQSVACGGLDSACSIFNLNSQADRDGNIPVSRILTGHKGYVSSCQYVPDQETRLIT SSGDQTCVLWDVTTGQRISIFGGEFPSGHTADVLRYILWIGPLKRIG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |