Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0449600_circ_g.3 |
| ID in PlantcircBase | osa_circ_028098 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 22070004-22070169 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0449600 |
| Parent gene annotation |
Similar to glycosyl hydrolase family 3 protein. (Os05t0449600-01 );Hypothetical conserved gene. (Os05t0449600-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0449750-00:1 Os05t0449600-01:1 Os05t0449750-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.48719749 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22070060-22070006(+) 22070110-22070148(-) |
| Potential amino acid sequence |
MSRIDDAVERILRVKFISGVFEHPFSDPSLADIIGCKI*(+) MNLTLRIRSTASSIRDIGISPASTKNTRSSKNFSNLTTNYIC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |