Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0161400_circ_g.4 |
| ID in PlantcircBase | osa_circ_026739 |
| Alias | Os_ciR3083 |
| Organism | Oryza sativa |
| Position | chr5: 3617187-3618285 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0161400 |
| Parent gene annotation |
Peptidase, trypsin-like serine and cysteine domain containing pr otein. (Os05t0161400-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0161400_circ_g.1 Os05g0161400_circ_g.2 Os05g0161400_circ_g.3 Os05g0161400_circ_g.5 Os05g0161400_circ_g.6 |
| Support reads | 4/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0161400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.440100546 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3617213-3617207(+) 3618219-3617207(+) |
| Potential amino acid sequence |
MELRAFELIEVSHQEEIELDHNINDGFIVAVVYDDSTAVRLGISQGDIILSYNGLHDFTLHKLE EFLLSLGWELLASGDPSWNVGLELVVYDAVRHATRSITYPLEFSDASERSYCSSSA*(+) MMQLDMLLDLLPIHWSFLMLLSGRIARPVLNMELRAFELIEVSHQEEIELDHNINDGFIVAVVY DDSTAVRLGISQGDIILSYNGLHDFTLHKLEEFLLSLGWELLASGDPSWNVGLELVVYDAVRHA TRSITYPLEFSDASERSYCSSSA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |