Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0161400_circ_g.4 |
ID in PlantcircBase | osa_circ_026739 |
Alias | Os_ciR3083 |
Organism | Oryza sativa |
Position | chr5: 3617187-3618285 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os05g0161400 |
Parent gene annotation |
Peptidase, trypsin-like serine and cysteine domain containing pr otein. (Os05t0161400-01) |
Parent gene strand | + |
Alternative splicing | Os05g0161400_circ_g.1 Os05g0161400_circ_g.2 Os05g0161400_circ_g.3 Os05g0161400_circ_g.5 Os05g0161400_circ_g.6 |
Support reads | 4/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0161400-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.440100546 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3617213-3617207(+) 3618219-3617207(+) |
Potential amino acid sequence |
MELRAFELIEVSHQEEIELDHNINDGFIVAVVYDDSTAVRLGISQGDIILSYNGLHDFTLHKLE EFLLSLGWELLASGDPSWNVGLELVVYDAVRHATRSITYPLEFSDASERSYCSSSA*(+) MMQLDMLLDLLPIHWSFLMLLSGRIARPVLNMELRAFELIEVSHQEEIELDHNINDGFIVAVVY DDSTAVRLGISQGDIILSYNGLHDFTLHKLEEFLLSLGWELLASGDPSWNVGLELVVYDAVRHA TRSITYPLEFSDASERSYCSSSA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |