Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0132200_circ_g.2 |
| ID in PlantcircBase | osa_circ_038495 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 2471065-2471554 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os09g0132200 |
| Parent gene annotation |
Esterase, SGNH hydrolase-type domain containing protein. (Os09t0 132200-01);Similar to anther-specific proline-rich protein APG. (Os09t0132200-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0132200_circ_g.1 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0132200-01:1 Os09t0132200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007954* |
| PMCS | 0.396561451 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2471161-2471547(-) |
| Potential amino acid sequence |
MISFATSSPLACFSFSMYSLKYSSCWLSGITDVV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |