Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0132200_circ_g.2 |
ID in PlantcircBase | osa_circ_038495 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 2471065-2471554 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os09g0132200 |
Parent gene annotation |
Esterase, SGNH hydrolase-type domain containing protein. (Os09t0 132200-01);Similar to anther-specific proline-rich protein APG. (Os09t0132200-02) |
Parent gene strand | + |
Alternative splicing | Os09g0132200_circ_g.1 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0132200-01:1 Os09t0132200-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007954* |
PMCS | 0.396561451 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2471161-2471547(-) |
Potential amino acid sequence |
MISFATSSPLACFSFSMYSLKYSSCWLSGITDVV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |