Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0002s11150_circ_g.2 |
ID in PlantcircBase | pop_circ_000704 |
Alias | Chr02:8209246-8210761 |
Organism | Populus trichocarpa |
Position | chr2: 8188118-8189633 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0002s11150 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | POPTR_0002s11150_circ_g.1 |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | POPTR_0002s11150.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.110630629 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8189583-8188146(+) 8188226-8189581(-) 8189529-8189577(-) |
Potential amino acid sequence |
MKLLVEVEYTAVGTPPHRGFMLAIILC*(+) MQRNKGQFTSAKKSEGGYGWDGGQDSAQDDSQHETSVWGSTHRGVLNLNEQLH*(-) MVSVRRLHSGCSGIRVNSPLPRSLREDMAGMVVRIQHKMIANMKPRCGGVPTAVYSTSTSSFIK *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |