Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0534800_circ_g.3 |
| ID in PlantcircBase | osa_circ_040013 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 21030611-21031135 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0534800 |
| Parent gene annotation |
Transcription initiation factor IIB (General transcription facto r TFIIB). (Os09t0534800-01);Similar to Transcription initiation factor IIB. (Os09t0534800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0534800-02:2 Os09t0534800-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.307968794 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21030918-21030683(+) |
| Potential amino acid sequence |
MGQSMEMGTIHAGDFLRRFCSTLGMNNQAVKAAQEAVQRSEELDIRTEPMKYIRRWKISSLSGE EIKMPY*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |