Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0557100_circ_g.1 |
ID in PlantcircBase | osa_circ_015031 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 21084112-21084352 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0557100 |
Parent gene annotation |
AIG1 domain containing protein. (Os02t0557100-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0557100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104771784 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21084131-21084149(+) 21084238-21084315(-) |
Potential amino acid sequence |
MGGSEYDDDWELPSADITVVLCGKLGCGKSATGNSIVGREAFVSEYSHASVTSTCQLASTALKD GRTLNVIDTPGFLRVCNGRKRIR*(+) MLLPVALLPQPSLPQRTTVMSALGNSQSSSYSLPPIANSQKTWRINNIEGTAIL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |