Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0268200_circ_g.3 |
| ID in PlantcircBase | osa_circ_019066 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8898450-8900572 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0268250 |
| Parent gene annotation |
Hypothetical protein. (Os03t0268250-00) |
| Parent gene strand | + |
| Alternative splicing | Os03g0268200_circ_g.2 Os03g0268200_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0268200-02:5 Os03t0268200-04:5 Os03t0268200-01:5 Os03t0268200-03:1 Os03t0268250-00:5 Os03t0268200-02:5 Os03t0268200-04:5 Os03t0268200-01:5 Os03t0268200-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.145452818 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8900569-8898510(+) 8899602-8900562(-) |
| Potential amino acid sequence |
MFSRFSPKHVQREMDGSQTLQR*(+) MAPEVMQAQKYDAKADLWSVGIILYQLVTGSPPFTGDSQIQLLRNILNTREIRFPSDCDLSHGC IDLCRKLLRINSVERLTVEEFVNHPFLAEHALERTLRTFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |