Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0160100_circ_g.3 |
| ID in PlantcircBase | osa_circ_032836 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 3225826-3225874 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os07g0160100 |
| Parent gene annotation |
Similar to cDNA clone:J023038F18, full insert sequence. (Os07t01 60100-01);YABBY family transcription factor, Stamen and carpel d evelopment, Feedback regulation of gibberellin biosynthesis (Os0 7t0160100-02);Similar to MADS-box transcription factor. (Os07t01 60100-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0160100-02:1 Os07t0160100-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187073469 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3225873-3225873(-) 3225860-3225873(-) |
| Potential amino acid sequence |
MNLLYADGTRCLFSGVDESVVCRWDTLSFLRG*(-) MQMGHAVFSQGLMNLLYADGTRCLFSGVDESVVCRWDTLSFLRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |