Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0477900_circ_g.2 |
| ID in PlantcircBase | osa_circ_039579 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 18310205-18311073 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0477900 |
| Parent gene annotation |
NusB/RsmB/TIM44 domain containing protein. (Os09t0477900-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0477900_circ_ag.1 Os09g0478100_circ_ag.1 Os09g0478100_circ_ag.3 Os09g0477900_circ_g.4 Os09g0478100_circ_ag.5 Os09g0478300_circ_g.1 Os09g0478300_circ_g.2 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0478100-01:3 Os09t0478100-02:3 Os09t0477900-01:2 Os09t0478100-01:3 Os09t0478100-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.616344517 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18310988-18310282(+) 18310978-18311070(-) |
| Potential amino acid sequence |
MVEMTRLGGSDCGSAVHTKISTPGRFCSYQSVQCPSFEVMVVLRPLLARHVYHCW*(+) MAYNYPSEKISVYLSDDGGSILTFYALWEASIFAKKWLPFCKRYNIEPRSPAAYFSESKVHHNL CIPKEWALIKNLYEEMRERIDTATMSGKIPEEMKLKHKGFDEWNSDFTLKNHQPIVQILIDGKN RNAIDDDRNVLPTMVYVAREKRPQYHHNFKAGALNALI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |