Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G61780_circ_g.10 |
| ID in PlantcircBase | ath_circ_045253 |
| Alias | At_ciR586, AT5G61780_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 24825227-24825421 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ, circseq_cup, CIRI-full, CIRI2 |
| Parent gene | AT5G61780 |
| Parent gene annotation |
Ribonuclease TUDOR 2 |
| Parent gene strand | + |
| Alternative splicing | AT5G61780_circ_g.11 AT5G61780_circ_g.12 AT5G61780_circ_g.13 |
| Support reads | 5/1 |
| Tissues | leaf/aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G61780.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.359234444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24825272-24825418(+) |
| Potential amino acid sequence |
MWEKNSKTNAGTYLLEAGLAKMQTGFGADRIPEAHILEMAERSAKNQKLKIVVENVDRTGTFLG SMWEKNSKTNAGTYLLEAGLAKMQTGFGADRIPEAHILEMAERSAKNQKLKIVVENVDRTGTFL GSMWEKNSKTNAGTYLLEAGLAKMQTGFGADRIPEAHILEMAERSAKNQKLKIVVENVDRTGTF LGSMWEKNSKTNAGTYLLEAGLAKMQTGFGADRIPEAHILEMAERSAKNQKLK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |