Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0757700_circ_g.1 |
| ID in PlantcircBase | osa_circ_016621 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 31909255-31909892 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0757700 |
| Parent gene annotation |
Cyclin-like F-box domain containing protein. (Os02t0757700-01);S imilar to Ubiquitin-protein ligase. (Os02t0757700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0757700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.202903487 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31909577-31909345(+) 31909268-31909324(-) |
| Potential amino acid sequence |
MGECGGGEYRCWEELLPDALGLVFRNLPLREVLTVVPRVCKSWSRVVAGPYCWQEIDIEEWRQQ QGKPEQLVRMVEMLVARSCGSCRRISVSGLPGDPLFSFIGDQGFLIWSLTRGVNKVYAPSKLLL LAASLILE*(+) MRKPWSPMKEKSGSPGRPETLMRRQEPQLRATSISTMRTSCSGLPCCCRHSSMSISCQQYGPAT TRLHDLHTRGTTVSTSRSGRFRKTSPSASGRSSSQHLYSPPPHSPISSSLSFCTWRSLKNQRSS *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |