Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G12740_circ_g.1 |
ID in PlantcircBase | ath_circ_002279 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 4343149-4343298 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G12740 |
Parent gene annotation |
Cytochrome P450, family 87, subfamily A, polypeptide 2 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G12740.4:1 AT1G12740.3:1 AT1G12740.1:1 AT1G12740.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.318858836 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4343149-4343295(+) |
Potential amino acid sequence |
MIFDLTAKKLISHDPDKSSENLRANFVAFIQGLISFPFDIPGTAYHKCLQMIFDLTAKKLISHD PDKSSENLRANFVAFIQGLISFPFDIPGTAYHKCLQMIFDLTAKKLISHDPDKSSENLRANFVA FIQGLISFPFDIPGTAYHKCLQMIFDLTAKKLISHDPDKSSENLRANFVAFIQGLISFPFDIPG TAYHKCLQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |