Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0134800_circ_g.4 |
| ID in PlantcircBase | osa_circ_032711 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 1864506-1864652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0134800 |
| Parent gene annotation |
Similar to Succinate dehydrogenase [ubiquinone] flavoprotein sub unit, mitochondrial (EC 1.3.5.1) (FP) (Flavoprotein subunit of c omplex II). (Os07t0134800-01);Similar to Succinate dehydrogenase . (Os07t0134800-04) |
| Parent gene strand | - |
| Alternative splicing | Os07g0134800_circ_g.1 Os07g0134800_circ_g.2 Os07g0134800_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0134800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.384925 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1864631-1864508(-) |
| Potential amino acid sequence |
MCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGDQDSIQYMCREAPKAVIELENY GLPFSRTEDGKIYQRAFGGQSLDFGKGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQR AFGGQSLDFGKGDQDSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |