Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0801000_circ_g.1 |
| ID in PlantcircBase | osa_circ_004439 |
| Alias | Os_ciR6192 |
| Organism | Oryza sativa |
| Position | chr1: 33919987-33920486 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0801000 |
| Parent gene annotation |
Similar to Apurinic endonuclease-redox protein (DNA-(apurinic or apyrimidinic site) lyase) (EC 4.2.99.18). (Os01t0801000-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0801000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010826 |
| PMCS | 0.145116967 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33920055-33920030(+) |
| Potential amino acid sequence |
MMAETRATYSRRAASKNTDIKKDDEHVLEKEDVAESKLEIEQLRNDPDRLQSMTVKELREITRM MGIPVKGNKKDLVSALMDSLGVAVGFQAQISVPAN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |