Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_11G158500_circ_g.1 |
| ID in PlantcircBase | gma_circ_006734 |
| Alias | gma-circRNA1505 |
| Organism | Glycine max |
| Position | chr11: 14179702-14180119 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_11G158500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH30101:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_045142 ath_circ_045141 |
| PMCS | 0.200095694 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14179786-14179743(+) 14180121-14180091(-) |
| Potential amino acid sequence |
MRRAATIPLAPTINPLKGTNTKSSSQVDLSCHGSSSDIVPVRIIRSQLLKSCSFHNISPLWQLH PLVSSSMMLMFCNC*(+) MELPEWTDIVKTARFKELAPYDPDWYYVRAASMARKIYLRGGLGVGAFQRIYGGSKRNGSRPPH FCKSSGAVARHILQQLQNMSIIELDTKGWSCQSGLIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |