Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0256000_circ_g.3 |
| ID in PlantcircBase | osa_circ_027179 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 9451571-9451854 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0256000 |
| Parent gene annotation |
Similar to TGF-beta receptor-interacting protein 1. (Os05t025600 0-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0256000_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0256000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207744513 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9451599-9451598(+) 9451846-9451635(+) 9451812-9451653(-) |
| Potential amino acid sequence |
MNVTMTDRRAGKFEAKFFHKILQEEIGGVKGHFGPINALAFNPDGRRWLSEVVKMR*(+) MDGGGYRRWSRCDECDYDRSSSGKI*(+) MAFYTTNFLLQNLVKEFRFKFSRSTICHSHIHRILTTSDNHLRPSGLNASALIGPKWPFTPPIS SCKIL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |