Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d012559_circ_g.2 |
ID in PlantcircBase | zma_circ_009811 |
Alias | Zm08circ00081, GRMZM2G310115_C1 |
Organism | Zea mays |
Position | chr8: 176644156-176644484 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d012559 |
Parent gene annotation |
Stomatal closure-related actin-binding protein 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d012559_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d012559_T003:2 Zm00001d012559_T001:2 Zm00001d012559_T009:1 Zm00001d012559_T006:2 Zm00001d012559_T010:2 Zm00001d012559_T004:2 Zm00001d012559_T005:2 Zm00001d012559_T002:2 Zm00001d012559_T008:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.19814556 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
176644443-176644185(+) 176644189-176644185(+) |
Potential amino acid sequence |
MVHKSKRVVFHYDEAAGLERYVDSLMKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRK GWSTKARESYSTTMKLQDLNVMWTH*(+) MKRTDIEFNVVVTQMNGKDYSSNSVHVFHIGKLRIKLRKGWSTKARESYSTTMKLQDLNVMWTH *(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |