Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G18300_circ_g.2 |
ID in PlantcircBase | ath_circ_013707 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 7953553-7953687 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, CIRI-full |
Parent gene | AT2G18300 |
Parent gene annotation |
Basic helix-loop-helix (BHLH) DNA-binding superfamily protein |
Parent gene strand | - |
Alternative splicing | AT2G18300_circ_g.1 AT2G18300_circ_g.3 |
Support reads | 1 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G18300.3:1 AT2G18300.2:1 AT2G18300.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.255646485 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7953661-7953555(-) |
Potential amino acid sequence |
MKYLQDIVPGCNKVTGKAGMLDEIINYVQCLQRQVEARREKISKKMKYLQDIVPGCNKVTGKAG MLDEIINYVQCLQRQVEARREKISKKMKYLQDIVPGCNKVTGKAGMLDEIINYVQCLQRQVEAR REKISKKMKYLQDIVPGCNKVTGKAGMLDEIINYVQCLQRQVE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |