Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0562800_circ_g.6 |
| ID in PlantcircBase | osa_circ_034273 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 22491332-22493437 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0562800 |
| Parent gene annotation |
Similar to Myosin heavy chain class VIII A2 protein. (Os07t05628 00-01);Similar to Myosin heavy chain class VIII A2 protein. (Os0 7t0562800-02);Similar to Myosin heavy chain class VIII A2 protei n. (Os07t0562800-03) |
| Parent gene strand | - |
| Alternative splicing | Os07g0562800_circ_g.3 Os07g0562800_circ_g.4 Os07g0562800_circ_g.5 Os07g0562800_circ_g.7 Os07g0562800_circ_g.8 Os07g0562800_circ_g.9 Os07g0562800_circ_g.10 Os07g0562800_circ_g.11 Os07g0562800_circ_g.12 Os07g0562800_circ_g.13 Os07g0562800_circ_g.14 Os07g0562800_circ_g.15 Os07g0562800_circ_g.16 Os07g0562800_circ_g.17 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0562800-02:6 Os07t0562800-01:6 Os07t0562800-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.153282554 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22492716-22491405(+) |
| Potential amino acid sequence |
MIIALEVSSQRELSSQHYPQIPHLPSQFHPLSIHDCKVIAPFFSPWYSCLVHNPRKFF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |