Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0104766_circ_g.1 |
| ID in PlantcircBase | osa_circ_010268 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 252301-252833 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0104766 |
| Parent gene annotation |
Similar to Clathrin heavy chain. (Os12t0104766-00) |
| Parent gene strand | + |
| Alternative splicing | Os12g0104766_circ_g.2 |
| Support reads | 93 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0104733-00:3 Os12t0104766-00:3 Os12t0104733-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.36507661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
252376-252491(+) |
| Potential amino acid sequence |
MQISQKYGLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTAESSASGGFYAINRRGQVLHA TVNDATIVPFVSSQLNNLELAVNLAKRANLPGAENLGNQGFPRSKLISSSPQIFRMIFLWPCRS LRSMALSM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |