Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G200900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001240 |
| Alias | Chr11:48679247|48680267 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 48679247-48680267 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G200900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G200900.4:2 Gorai.011G200900.3:2 Gorai.011G200900.1:2 Gorai.011G200900.2:2 Gorai.011G200900.5:2 Gorai.011G200900.6:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.454270323 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48679253-48679286(+) 48679250-48679383(-) |
| Potential amino acid sequence |
MDESENSTDSVLKHKPLWASYNSKVGKDKKKKKQKKKGDLHPTYGTRVIPVFVLSLADVDPQLM MEDEGFVWTGNDVVIVLEHQSPNIPLSIGWMNPRIQLIRF*(+) MLSGIFGLWCSSTMTTSFPVQTKPSSSIISCGSTSANDSTKTGITLVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |