Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0592600_circ_g.1 |
ID in PlantcircBase | osa_circ_009721 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 22553217-22553298 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os11g0592600 |
Parent gene annotation |
Targeting for Xklp2 family protein. (Os11t0592600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0592600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.221544715 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22553229-22553273(+) 22553226-22553226(-) |
Potential amino acid sequence |
MEGPQQFQQAQFSDVLNVPRSAEKKSSNGRTTTVPAGPVFRCTERAEKRREEIIKWKDHNSSSR PSFQMY*(+) MISSLRFSARSVHLKTGPAGTVVVLPFDDFFSALLGTFSTSENWACWNCCGPSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |