Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G11130_circ_g.3 |
| ID in PlantcircBase | ath_circ_020966 |
| Alias | At_ciR5327, AT3G11130_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3483307-3483492 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | AT3G11130 |
| Parent gene annotation |
Clathrin heavy chain 1 |
| Parent gene strand | - |
| Alternative splicing | AT3G11130_circ_g.2 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G11130.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.693828544 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3483469-3483309(-) |
| Potential amino acid sequence |
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMR RVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMRRV AAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMRRVAA YIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Zhang et al., 2019 |