Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G11130_circ_g.3 |
ID in PlantcircBase | ath_circ_020966 |
Alias | At_ciR5327, AT3G11130_C1 |
Organism | Arabidpsis thaliana |
Position | chr3: 3483307-3483492 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | AT3G11130 |
Parent gene annotation |
Clathrin heavy chain 1 |
Parent gene strand | - |
Alternative splicing | AT3G11130_circ_g.2 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G11130.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.693828544 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3483469-3483309(-) |
Potential amino acid sequence |
MRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMR RVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMRRV AAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQIEKHELVEMRRVAA YIYKKAGRWKQSIALSKKDNMYKDCMETASQSGDHDLAEQLLVYFIEQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Zhang et al., 2019 |