Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G151300_circ_g.1 |
| ID in PlantcircBase | gra_circ_001409 |
| Alias | Chr13:41267132|41271444 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 41267132-41271444 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G151300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-No |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.013G151300.1:15 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.434938162 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41267271-41271421(-) |
| Potential amino acid sequence |
MFSSISACASSSSLARCSSIALDFSSISVSSEWESEPEPEVELEPLSCFRYFFF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |