Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018287_circ_g.2 |
ID in PlantcircBase | zma_circ_008827 |
Alias | Zm05circ00135, GRMZM2G039683_C1 |
Organism | Zea mays |
Position | chr5: 217942916-217943633 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d018287 |
Parent gene annotation |
ATP-dependent DNA helicase Q-like 3 |
Parent gene strand | - |
Alternative splicing | Zm00001d018287_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d018287_T004:4 Zm00001d018287_T007:4 Zm00001d018287_T010:4 Zm00001d018287_T001:4 Zm00001d018287_T002:4 Zm00001d018287_T005:4 Zm00001d018287_T008:4 Zm00001d018287_T003:4 Zm00001d018287_T009:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.12024368 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
217942988-217943441(-) |
Potential amino acid sequence |
MQNLKHWSVLKMLITKAKVRRSSRLLTTVKFLAAGGKRSLRALERKYNQLYANAHAMLANTQI* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |