Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d018287_circ_g.2 |
| ID in PlantcircBase | zma_circ_008827 |
| Alias | Zm05circ00135, GRMZM2G039683_C1 |
| Organism | Zea mays |
| Position | chr5: 217942916-217943633 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d018287 |
| Parent gene annotation |
ATP-dependent DNA helicase Q-like 3 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d018287_circ_g.1 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d018287_T004:4 Zm00001d018287_T007:4 Zm00001d018287_T010:4 Zm00001d018287_T001:4 Zm00001d018287_T002:4 Zm00001d018287_T005:4 Zm00001d018287_T008:4 Zm00001d018287_T003:4 Zm00001d018287_T009:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.12024368 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
217942988-217943441(-) |
| Potential amino acid sequence |
MQNLKHWSVLKMLITKAKVRRSSRLLTTVKFLAAGGKRSLRALERKYNQLYANAHAMLANTQI* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |