Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0323700_circ_g.4 |
| ID in PlantcircBase | osa_circ_036730 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 14193414-14193524 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0323700 |
| Parent gene annotation |
Cation-chloride cotransporter, Regulation of ion (Cl-, K+ and Na +) homeostasis, Cell elongation, Osmoregulation (Os08t0323700-01 ) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0323700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.173425676 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14193502-14193488(+) 14193504-14193416(-) |
| Potential amino acid sequence |
MLGSTVRFLLRPKIFTRESKPKSSSFESPCETV*(+) MQEDHTVSQGDSKLELFGFDSLVNILGLKRNLTVDPSMQEDHTVSQGDSKLELFGFDSLVNILG LKRNLTVDPSMQEDHTVSQGDSKLELFGFDSLVNILGLKRNLTVDPSMQEDHTVSQGDSKLELF GFDSLVNILGLK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |