Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0153200_circ_g.1 |
| ID in PlantcircBase | osa_circ_029715 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 2745069-2748316 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0153200 |
| Parent gene annotation |
Similar to cDNA clone:J023129O11, full insert sequence. (Os06t01 53200-01);Similar to phosphate translocator-related. (Os06t01532 00-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0153200_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0153200-02:7 Os06t0153200-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.33486709 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2748240-2745987(+) 2746058-2748232(-) |
| Potential amino acid sequence |
MTWRTRMSFRMKIHNFAMWQHFNCHLVGESQHQASRNNCSYLYWGSLDSFKGD*(+) MDQRNPDITAASVTKMNPQKSNSVSFETVKRTPVEITTIIPRSLMLGLSNQVTVKMLPHCKIMY LHPETHPGPPSHLE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |