Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0771100_circ_g.7 |
ID in PlantcircBase | osa_circ_016714 |
Alias | Os02circ27700 |
Organism | Oryza sativa |
Position | chr2: 32529840-32530357 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0771100 |
Parent gene annotation |
Similar to COP1 (Fragment). (Os02t0771100-01);Similar to CopI. ( Os02t0771100-02);Similar to COP1 (Fragment). (Os02t0771100-03) |
Parent gene strand | - |
Alternative splicing | Os02g0771100_circ_g.2 Os02g0771100_circ_g.3 Os02g0771100_circ_g.4 Os02g0771100_circ_g.5 Os02g0771100_circ_g.6 |
Support reads | 3 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0771100-01:3 Os02t0771100-03:3 Os02t0771100-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012344 |
PMCS | 0.349305985 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32530302-32529863(+) 32530146-32530348(-) 32529852-32530348(-) |
Potential amino acid sequence |
MRFETPAVANSSSSRSNSILAIITPRY*(+) MATRSKLSCLSWNKYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHEKRAWSVDFSRTEPSMLV SGSDDCKYRI*(-) MIASIEFDRDDELFATAGVSKRIKVFEFSTVVNEPSDVHCPVVEMATRSKLSCLSWNKYSKNVI ASSDYEGIVTVWDVQTRQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKYRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |