Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0771100_circ_g.7 |
| ID in PlantcircBase | osa_circ_016714 |
| Alias | Os02circ27700 |
| Organism | Oryza sativa |
| Position | chr2: 32529840-32530357 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os02g0771100 |
| Parent gene annotation |
Similar to COP1 (Fragment). (Os02t0771100-01);Similar to CopI. ( Os02t0771100-02);Similar to COP1 (Fragment). (Os02t0771100-03) |
| Parent gene strand | - |
| Alternative splicing | Os02g0771100_circ_g.2 Os02g0771100_circ_g.3 Os02g0771100_circ_g.4 Os02g0771100_circ_g.5 Os02g0771100_circ_g.6 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0771100-01:3 Os02t0771100-03:3 Os02t0771100-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012344 |
| PMCS | 0.349305985 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32530302-32529863(+) 32530146-32530348(-) 32529852-32530348(-) |
| Potential amino acid sequence |
MRFETPAVANSSSSRSNSILAIITPRY*(+) MATRSKLSCLSWNKYSKNVIASSDYEGIVTVWDVQTRQSVMEYEEHEKRAWSVDFSRTEPSMLV SGSDDCKYRI*(-) MIASIEFDRDDELFATAGVSKRIKVFEFSTVVNEPSDVHCPVVEMATRSKLSCLSWNKYSKNVI ASSDYEGIVTVWDVQTRQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKYRI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |