Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G63500_circ_g.1 |
| ID in PlantcircBase | ath_circ_008512 |
| Alias | At_ciR4052 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 23556985-23557268 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT1G63500 |
| Parent gene annotation |
BSK7 |
| Parent gene strand | + |
| Alternative splicing | AT1G63500_circ_g.2 AT1G63500_circ_g.3 |
| Support reads | 5 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G63500.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.301253457 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23557018-23557265(+) |
| Potential amino acid sequence |
MKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSHDSNPRLSCFGL MKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSHDSNPRLSCFGL MKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSHDSNPRLSCFGL MKNSRDGKSYSTNLAFTPPEYLRTGRVTPESVMYSYGTLLLDLLSGKHIPPSH(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |