Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d013006_circ_g.2 |
ID in PlantcircBase | zma_circ_008345 |
Alias | Zm05circ00003, GRMZM2G095865_C1 |
Organism | Zea mays |
Position | chr5: 3139887-3141192 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d013006 |
Parent gene annotation |
DNA gyrase subunit A chloroplastic/mitochondrial |
Parent gene strand | + |
Alternative splicing | Zm00001d013006_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d013006_T010:2 Zm00001d013006_T001:2 Zm00001d013006_T016:3 Zm00001d013006_T003:2 Zm00001d013006_T013:3 Zm00001d013006_T020:3 Zm00001d013006_T009:3 Zm00001d013006_T015:2 Zm00001d013006_T018:2 Zm00001d013006_T002:3 Zm00001d013006_T004:2 Zm00001d013006_T017:3 Zm00001d013006_T007:3 Zm00001d013006_T005:3 Zm00001d013006_T014:3 Zm00001d013006_T019:3 Zm00001d013006_T008:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.046389599 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3139913-3139909(+) 3140949-3141158(-) |
Potential amino acid sequence |
MGLKEILQAFLDFRCSVIERRARYKLSQALERKHIVEGIVIGLDNLDAVIQIIRETSNHTAATR ALVNVYLMGSQN*(+) MPEEFLSVPSILAAHQVYIDKSSCCRSVI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |