Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0010s08030_circ_g.1 |
| ID in PlantcircBase | pop_circ_002708 |
| Alias | Chr10:9659662-9661002 |
| Organism | Populus trichocarpa |
| Position | chr10: 8995450-8996790 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0010s08030 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | POPTR_0010s08030.2:3 POPTR_0010s08030.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.113775659 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8996728-8995481(+) 8996768-8996771(-) |
| Potential amino acid sequence |
MVQKQFLDQLKPPSSISLLKFTGQPKKTIGTT*(+) MEASAGQGTVFAPSLEGMKHVRSDNGEILTKPFLDVCKLILPVIDKFGAAMALVKSDIGGNITR LETKYLSDPSKYNQFYTMVQEEADAKTAKGSSSCANGLLWLTSEFEERN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |