Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0126825_circ_g.3 |
| ID in PlantcircBase | osa_circ_017712 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 1516622-1516711 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0126825 |
| Parent gene annotation |
Hypothetical gene. (Os03t0126825-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0126825_circ_g.1 Os03g0126825_circ_g.2 Os03g0126825_circ_g.4 Os03g0126825_circ_g.5 |
| Support reads | 1 |
| Tissues | anther |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0126800-00:1 Os03t0126800-00:1 Os03t0126825-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.103703704 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1516683-1516669(+) 1516645-1516708(+) |
| Potential amino acid sequence |
MWTRNFCLADCAGIRIKYALNELLRT*(+) MRLMNFFAPEENQCGQETFALQIVQGLGSSMRLMNFFAPEENQCGQETFALQIVQGLGSSMRLM NFFAPEENQCGQETFALQIVQGLGSSMRLMNFFAPEENQCGQETFALQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |