Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0741300_circ_g.2 |
| ID in PlantcircBase | osa_circ_016487 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 31005380-31007894 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0741300 |
| Parent gene annotation |
Glycoside hydrolase, family 47 protein. (Os02t0741300-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0741300_circ_g.3 Os02g0741300_circ_g.4 Os02g0741300_circ_g.5 Os02g0741300_circ_g.6 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0741300-01:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15635325 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31006470-31005422(+) |
| Potential amino acid sequence |
MENETTETSTSGCGSLILEMGALSRLTGDSRYEAAALRALRKLWSMRSSLNLVGTTLDVLTGKW IEYSSGIGAGVDSFYEYLIKAYVLFGSEEYWDMFHSAYLAVQKYFRHGPWYHEADMRTGEATHW QLTSLQAFWPGLQTLLGDVAAANISHREFYNVWQRFGVLPERYLLDFGMLHPTEKYYPLRPEFA ESTFYLYQATKDPWYLEVGEAIIGSLNYYTKVDGGFASVRDVSTMKLEDHQHSFFLSETLNICQ MITMDLHLH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |