Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0187400_circ_g.2 |
ID in PlantcircBase | osa_circ_033060 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 4665437-4666209 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0187400 |
Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os07t0187400- 00) |
Parent gene strand | - |
Alternative splicing | Os07g0187400_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0187400-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007074* |
PMCS | 0.24415622 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4666093-4666204(-) |
Potential amino acid sequence |
MQVPKVSMQHNVMIEAVENHMPEVIVIDEIGTELEAMAASTIAQRGVQLVGTAHGVTIESIIKN PCLQVLVGGIESVTLGDEEAKKRKVQKTILERKGPPTFSCAVEMISKTECRVHHKLEATVDAIL AGK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |