Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0504500_circ_g.1 |
ID in PlantcircBase | osa_circ_014732 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 17931180-17931330 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0504500 |
Parent gene annotation |
PUG domain containing protein. (Os02t0504500-01);Similar to pred icted protein. (Os02t0504500-02) |
Parent gene strand | + |
Alternative splicing | Os02g0504500_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0504500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.276610762 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17931235-17931223(+) 17931299-17931223(+) 17931297-17931222(-) |
Potential amino acid sequence |
MEAAKPIDLEAAPPKPAGEAMDVDASASAEPQGGGPAHQAHGPHGVH*(+) MSMPRQAPSHKEVDLHTKRTGHTEFTDKTMEAAKPIDLEAAPPKPAGEAMDVDASASAEPQGGG PAHQAHGPHGVH*(+) MASPAGFGGAASRSIGLAASMVLSVNSVWPVRLVCRSTSLWLGACRGIDIHGLAGRLRRRRLEI NWLGRLHGLVSELRVARALGVQVHLLVARRLPRHRHPWPRRPASAAPPRDQLAWPPPWSCQ*(- ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |