Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0883000_circ_g.1 |
ID in PlantcircBase | osa_circ_005092 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 38322537-38322728 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os01g0883100 |
Parent gene annotation |
Similar to PISTILLATA-like MADS box protein. (Os01t0883100-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | NA:0 Os01t0883100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.137586458 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38322730-38322539(-) |
Potential amino acid sequence |
MDHWERHVRTDKMLEDENKLLAFKLMDHWERHVRTDKMLEDENKLLAFKLMDHWERHVRTDKML EDENKLLAFKLMDHWERHVRTDKMLEDENKLLAFKL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |