Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0764600_circ_g.1 |
| ID in PlantcircBase | osa_circ_022014 |
| Alias | Os03circ27386 |
| Organism | Oryza sativa |
| Position | chr3: 31644361-31644506 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os03g0764600 |
| Parent gene annotation |
Homeodomain-like containing protein. (Os03t0764600-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/1 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0764600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.271177397 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31644450-31644360(+) |
| Potential amino acid sequence |
MDEHRAALGGQPRQRRRFRVIELMKEEAGKRRKDGDDAEAKAEDGDKTKWMSTAQLWVDSRGSD ADSE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |