Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G28950_circ_g.3 |
ID in PlantcircBase | ath_circ_033420 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 14278817-14279092 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G28950 |
Parent gene annotation |
Rac-like GTP-binding protein ARAC7 |
Parent gene strand | + |
Alternative splicing | AT4G28950_circ_g.1 AT4G28950_circ_g.2 AT4G28950_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G28950.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242281796 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14279032-14279089(+) |
Potential amino acid sequence |
MPELRRFAPNVPIVLVGTKLGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRR FAPNVPIVLVGTKLGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVP IVLVGTKLGQEDYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGT KL(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |