Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G28060_circ_g.5 |
| ID in PlantcircBase | ath_circ_040879 |
| Alias | AT5G28060_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 10070156-10070477 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT5G28060 |
| Parent gene annotation |
40S ribosomal protein S24-2 |
| Parent gene strand | - |
| Alternative splicing | AT5G28060_circ_g.1 AT5G28060_circ_g.2 AT5G28060_circ_g.3 AT5G28060_circ_g.4 |
| Support reads | 3/7 |
| Tissues | whole_plant/seedlings, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G28060.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.455260656 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10070300-10070158(-) |
| Potential amino acid sequence |
MYEVKDPNAIFCFKFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRVIDVLHPGRANVSKAE LKEKLARMYEVKDPNAIFCFKFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRVIDVLHPGR ANVSKAELKEKLARMYEVKDPNAIFCFKFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRVI DVLHPGRANVSKAELKEKLARMYEVKDPNAIFCFKFRTHFGGGKSSGYGLIYDTVENAKKFEPK YRLIR(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress; responsive to heat stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Pan et al., 2017;Zhang et al., 2019 |