Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0155100_circ_g.3 |
| ID in PlantcircBase | osa_circ_035897 |
| Alias | Os_ciR11631 |
| Organism | Oryza sativa |
| Position | chr8: 3172660-3173397 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0155100 |
| Parent gene annotation |
PapD-like domain containing protein. (Os08t0155100-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0155100_circ_g.1 Os08g0155100_circ_g.2 Os08g0155100_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0155100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186675926 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3173289-3172660(+) 3172690-3172668(+) 3172692-3173302(-) |
| Potential amino acid sequence |
MCQRLHPPQCLKTLNKEVLLGHLHKKMVSIIQQCHNL*(+) MQLTNKTDHYVAFKVKTTNPKQYCVRPNIGVVLPGSTCDVTVTMQAQREAPPDMQCKDKFLVQS VAAENGATTQDISAEMFNKVAGKVVEEFKLRVVYVPTTTSSAMPEDSEQGSSARPFAQENGIHN STMPQPLNY*(+) MEHELCFSSSKVVALLNYGYHFLVQMAEQNFLVQSLQALRRM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |