Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G43320_circ_g.10 |
ID in PlantcircBase | ath_circ_042192 |
Alias | AT5G43320_C2, AT5G43320_C2 |
Organism | Arabidpsis thaliana |
Position | chr5: 17388587-17388790 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT5G43320 |
Parent gene annotation |
Casein kinase 1-like protein 8 |
Parent gene strand | - |
Alternative splicing | AT5G43320_circ_g.2 AT5G43320_circ_g.3 AT5G43320_circ_g.4 AT5G43320_circ_g.5 AT5G43320_circ_g.6 AT5G43320_circ_g.7 AT5G43320_circ_g.8 AT5G43320_circ_g.9 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G43320.3:2 AT5G43320.1:2 AT5G43320.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.274273327 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17388624-17388757(-) 17388607-17388589(-) |
Potential amino acid sequence |
MNQSFICFFKEEGLMYKLEKKLL* MLLQGGRVNVQTGEEVAVKLEPARARHPQLHYESKLYMLLQGGRVNVQTGEEVAVKLEPARARH PQLHYESKLYMLLQGGRVNVQTGEEVAVKLEPARARHPQLHYESKLYMLLQGG |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |