Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0273000_circ_g.1 |
| ID in PlantcircBase | osa_circ_014211 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 9930346-9930583 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0273000 |
| Parent gene annotation |
Similar to Uridine kinase-like protein. (Os02t0273000-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0273000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.540036485 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9930553-9930400(+) 9930555-9930539(-) 9930575-9930539(-) |
| Potential amino acid sequence |
MPAMHSPYSHHCSQYGIQQQHMPVCNIFR*(+) MLQRYKNWEDSYSQGRRQWQTANLSQFTERYCKQACAVVGSHTGNSGESMENALRACCKGIKIG KILIHREGDNGKQLIYHNLPKDIANRHVLLLDPILGTVVRVWRMHCGHAAKV*(-) MENALRACCKGIKIGKILIHREGDNGKQLIYHNLPKDIANRHVLLLDPILGTVVRVWRMHCGHA AKV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |