Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0273000_circ_g.1 |
ID in PlantcircBase | osa_circ_014211 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 9930346-9930583 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os02g0273000 |
Parent gene annotation |
Similar to Uridine kinase-like protein. (Os02t0273000-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0273000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.540036485 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9930553-9930400(+) 9930555-9930539(-) 9930575-9930539(-) |
Potential amino acid sequence |
MPAMHSPYSHHCSQYGIQQQHMPVCNIFR*(+) MLQRYKNWEDSYSQGRRQWQTANLSQFTERYCKQACAVVGSHTGNSGESMENALRACCKGIKIG KILIHREGDNGKQLIYHNLPKDIANRHVLLLDPILGTVVRVWRMHCGHAAKV*(-) MENALRACCKGIKIGKILIHREGDNGKQLIYHNLPKDIANRHVLLLDPILGTVVRVWRMHCGHA AKV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |