Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0685900_circ_g.1 |
| ID in PlantcircBase | osa_circ_003336 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 28285153-28286411 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0685900 |
| Parent gene annotation |
Similar to 65kD microtubule associated protein. (Os01t0685900-01 );Similar to 65kD microtubule associated protein. (Os01t0685900- 02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0685900_circ_g.2 Os01g0685900_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0685900-02:6 Os01t0685900-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16654908 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28285199-28285160(+) |
| Potential amino acid sequence |
MKDLVLKKKAELEEHRRRAHLVGEEGYAEEFSIEAIEAGAIDPSLVLEQIEAHIATVKEEAFSR KDILEKVERWQNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARTLVNKIPGMVDVLRTKI AAWKNERGKEDFTYDGVSLSSMLDEYMFVRQEKEQEKKRQRDQKKLQDQLKAEQEALYGSKPSP SKPLSTKKAPRHSMGGANRRLSLGGATMQPPKTDILHSKSVRAAKKTEEIGTLSPSRI*(+) |
| Sponge-miRNAs | osa-miR2928 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |