Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0685900_circ_g.1 |
ID in PlantcircBase | osa_circ_003336 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 28285153-28286411 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0685900 |
Parent gene annotation |
Similar to 65kD microtubule associated protein. (Os01t0685900-01 );Similar to 65kD microtubule associated protein. (Os01t0685900- 02) |
Parent gene strand | + |
Alternative splicing | Os01g0685900_circ_g.2 Os01g0685900_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0685900-02:6 Os01t0685900-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.16654908 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28285199-28285160(+) |
Potential amino acid sequence |
MKDLVLKKKAELEEHRRRAHLVGEEGYAEEFSIEAIEAGAIDPSLVLEQIEAHIATVKEEAFSR KDILEKVERWQNACEEEAWLEDYNKDDNRYNAGRGAHLTLKRAEKARTLVNKIPGMVDVLRTKI AAWKNERGKEDFTYDGVSLSSMLDEYMFVRQEKEQEKKRQRDQKKLQDQLKAEQEALYGSKPSP SKPLSTKKAPRHSMGGANRRLSLGGATMQPPKTDILHSKSVRAAKKTEEIGTLSPSRI*(+) |
Sponge-miRNAs | osa-miR2928 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |