Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0415700_circ_g.1 |
| ID in PlantcircBase | osa_circ_027906 |
| Alias | Os05circ10956 |
| Organism | Oryza sativa |
| Position | chr5: 20317964-20318742 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os05g0415700 |
| Parent gene annotation |
Glycoside hydrolase, family 20 protein. (Os05t0415700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf and panicle |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0415600-01:1 Os05t0415600-01:1 Os05t0415700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133747358 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20318336-20317992(+) |
| Potential amino acid sequence |
MEFFQISARFLSSSLSIWEVMRSIQVAGLPHHALKHGMLNDEVSMS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |