Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0762800_circ_g.1 |
| ID in PlantcircBase | osa_circ_016666 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 32127095-32127917 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0762800 |
| Parent gene annotation |
Similar to ATRAD54/CHR25 (ARABIDOPSIS HOMOLOG OF RAD54); ATP bin ding / DNA binding / helicase. (Os02t0762800-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0762800-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012327 |
| PMCS | 0.251943337 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32127867-32127914(-) 32127101-32127914(-) |
| Potential amino acid sequence |
MVLDGSKFDSAATEHEASNSGENSYIDIGGFGAISGCVQKMNSSNQQIGSPSEEDLGSWGHHSD PSTVPDTILQCSSGDEV*(-) MRSEIHENLKCNRCNKDGCMVLDGSKFDSAATEHEASNSGENSYIDIGGFGAISGCVQKMNSSN QQIGSPSEEDLGSWGHHSDPSTVPDTILQCSSGDEV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |