Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0762800_circ_g.1 |
ID in PlantcircBase | osa_circ_016666 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 32127095-32127917 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0762800 |
Parent gene annotation |
Similar to ATRAD54/CHR25 (ARABIDOPSIS HOMOLOG OF RAD54); ATP bin ding / DNA binding / helicase. (Os02t0762800-00) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0762800-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012327 |
PMCS | 0.251943337 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32127867-32127914(-) 32127101-32127914(-) |
Potential amino acid sequence |
MVLDGSKFDSAATEHEASNSGENSYIDIGGFGAISGCVQKMNSSNQQIGSPSEEDLGSWGHHSD PSTVPDTILQCSSGDEV*(-) MRSEIHENLKCNRCNKDGCMVLDGSKFDSAATEHEASNSGENSYIDIGGFGAISGCVQKMNSSN QQIGSPSEEDLGSWGHHSDPSTVPDTILQCSSGDEV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |