Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d009930_circ_g.2 |
ID in PlantcircBase | zma_circ_009651 |
Alias | Zm08circ00042 |
Organism | Zea mays |
Position | chr8: 90341860-90343147 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d009930 |
Parent gene annotation |
Protein ABCI12 chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d009930_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d009930_T001:4 Zm00001d009930_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1453147 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
90343101-90342568(-) |
Potential amino acid sequence |
MRFGLVVFLALISMWVLPNHVWKDQLGRVTLLSGFIFIMLGFGADGAPSLVQMRTPPPSVLGIP NIPCSTSGYSYTILKLGPLQFTRKGLSLASTSASLSFAIFQSASLCLTTTTPEQLASALWWFMS PLKHIGVPVPEIILTLLLSLRFINLVFDEVRNSALAIVARRINWKKLTAMETIDSVALVPCCPT SQVKYLYAVWFGSIPGPYFNVGFTKSCLEGSTWKGYSSFRIHIHHAGIWC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |